A practical reference on method validation: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
This page was last updated on 2026-03-21 and is reviewed periodically as new material appears.
Key performance measures include retention time, peak area, peak height, resolution, tailing factor, and plate count. Retention time helps identify a peak under fixed conditions, but confirmation often requires a second method or detector. Peak area and height relate to concentration through calibration curves, which may be linear or nonlinear depending on the detector response. Resolution describes separation between adjacent peaks, while tailing factor and plate count describe peak shape and column efficiency. Performance checks verify these values before and during a run to confirm that the instrument is performing within limits.
High-performance liquid chromatography testing separates components of a liquid sample by forcing a mobile phase through a packed column. The stationary phase inside the column interacts with analytes to different degrees, so each compound exits at a characteristic retention time. A pump delivers solvent at controlled flow and pressure, while an injector introduces a precise sample volume. Detectors such as ultraviolet-visible, fluorescence, refractive index, or mass spectrometric instruments record the separated bands. The resulting chromatogram provides qualitative and quantitative information about the mixture.
Separation modes differ by the chemistry of the stationary phase and the composition of the mobile phase. Reversed-phase testing uses a nonpolar column and polar solvents, making it common for pharmaceutical, environmental, and food analytes. Normal-phase testing uses a polar column and nonpolar solvents for compounds that are poorly retained in reversed-phase systems. Ion-exchange and ion-pair methods separate charged species, while size-exclusion methods sort molecules by hydrodynamic volume. Gradient elution changes solvent strength over time to resolve complex mixtures, and isocratic elution holds solvent composition constant for simpler assays.
Detection in HPLC testing commonly relies on ultraviolet-visible absorbance, fluorescence, refractive index, or mass spectrometry. UV detection is widely used because many organic compounds absorb light, but it requires a chromophore. Mass spectrometry provides mass-based identification and high sensitivity for trace analytes. Each detector has trade-offs in selectivity, cost, and compatibility with mobile phases. Quantification typically uses calibration curves prepared from reference standards. Results are reported as concentration, purity, or presence above a limit.
HPLC testing separates dissolved compounds by passing a liquid sample through a column packed with stationary phase. A pump delivers mobile phase at controlled flow, and the sample components interact differently with stationary and mobile phases. Compounds that spend more time in mobile phase elute earlier; those retained by stationary phase elute later. Detectors record elution as peaks, and peak area or height relates to amount. This mechanism underpins quantitative analysis of mixtures.
| Property | Value | Notes |
|---|---|---|
| Separation mode | Reversed-phase | Common for polar and moderately polar analytes |
| Typical column length | 100-250 mm | Shorter columns can reduce run time |
| Particle size | 3-5 micrometers | Smaller particles improve efficiency but raise pressure |
| Flow rate | 0.5-2.0 mL/min | Depends on column dimensions and pressure limits |
| Detection | UV-Vis absorbance | Widely used for compounds with chromophores |
Routine quality control monitors retention time shifts, baseline noise, system pressure, and peak shape. Trends can reveal column aging, mobile phase preparation errors, detector drift, or sample degradation. Corrective actions may include replacing the column, preparing fresh mobile phase, or recalibrating the detector. Stability testing often uses HPLC to measure parent compound loss and degradation product formation. Open questions remain about how accelerated stability results extrapolate to long-term storage under varied conditions.
Quality control for HPLC testing combines scheduled checks, documented procedures, and review of results. Before sample analysis, system suitability testing confirms that the instrument, column, and method meet predefined criteria. Common criteria include resolution between critical peaks, retention time precision, peak tailing, and theoretical plate count. Failure triggers investigation before results are reported. Records link raw data, calculations, instrument logs, and analyst identity to each batch, supporting audits and repeat analysis.
Method validation evaluates accuracy, precision, specificity, linearity, range, detection limit, quantitation limit, and robustness. Regulatory guidance for pharmaceuticals, foods, and environmental testing defines expected documentation and acceptance criteria. Verification confirms that a validated method works in a specific laboratory with its own instruments and reagents. Calibration curves use reference standards with known purity and traceability, while measurement uncertainty is estimated from validation data, control charts, and collaborative studies. The scope of validation depends on the method's intended use.
Regulatory and pharmacopeial texts shape how HPLC testing is performed and documented. The International Council for Harmonisation provides validation guidance, while pharmacopeias publish general chromatography chapters and monographs for specific materials. Accreditation standards such as ISO/IEC 17025 address laboratory competence and traceability. Inspectors may review instrument qualification, analyst training, reference material control, and electronic records. Open questions include how best to validate methods for new complex products and how to handle automated data processing. Laboratories generally resolve these issues through risk assessment, method lifecycle management, and documented scientific justification.
In quality control laboratories, HPLC testing supports batch release, raw material checks, stability studies, and impurity profiling. A validated method defines sample preparation, instrument settings, calibration, and acceptance criteria. Analysts compare results with specifications and investigate out-of-specification outcomes before a batch is approved. Documentation includes chromatograms, integration records, audit trails, and reagent details. Because results influence product decisions, laboratories follow formal quality systems and data integrity rules. The exact tests and limits depend on the material, its intended use, and the applicable regulatory framework.
Method validation examines whether an HPLC procedure is suitable for its intended purpose. Common parameters include accuracy, precision, specificity, linearity, range, detection limit, quantification limit, and robustness. Accuracy describes closeness to a true or accepted value, while precision describes agreement among repeated measurements. Specificity shows whether the method can measure the analyte without interference from related substances. Robustness tests small deliberate changes in flow, temperature, or solvent composition. Validation is not a one-time event; methods may need partial revalidation after changes to instruments, columns, sample handling, or specification limits. Regulatory guidance provides frameworks, but some details remain method-specific.
Pituitary adenylate cyclase-activating polypeptide type I receptor also known as PAC1, is a protein that in humans is encoded by the ADCYAP1R1 gene. This receptor binds pituitary adenylate cyclase activating peptide. PAC1 is a membrane-associated protein and shares significant homology with members of the G-protein coupled class B glucagon/secretin receptor family. This receptor mediates diverse biological actions of adenylate cyclase activating polypeptide 1 and is positively coupled to adenylate cyclase. Alternative splicing of two exons of this gene generates four major splice variants, but their full-length nature has not been determined. PAC1 is expressed in the adrenal medulla, pancreatic acini, uterus, myenteric plexus and brain. It is also expressed in the trigeminal, otic and superior cervical ganglia (prejunctional) and cerebral arteries (postjunctional).
A lot of effort has been put into controlling cell selectivity. For example, attempts have been made to modify and optimize the physicochemical parameters of the peptides to control the selectivities, including net charge, helicity, hydrophobicity per residue (H), hydrophobic moment (μ) and the angle subtended by the positively charged polar helix face (Φ). Other mechanisms like the introduction of D-amino acids and fluorinated amino acids in the hydrophobic phase are believed to break the secondary structure and thus reduce hydrophobic interaction with mammalian cells. It has also been found that Pro→Nlys substitution in Pro-containing β-turn antimicrobial peptides was a promising strategy for the design of new small bacterial cell-selective antimicrobial peptides with intracellular mechanisms of action. It has been suggested that direct attachment of magainin to the substrate surface decreased nonspecific cell binding and led to improved detection limit for bacterial cells such as Salmonella and E. coli.
As a prototypical transaminase, AST relies on PLP (vitamin B6) as a cofactor to transfer the amino group from aspartate or glutamate to the corresponding ketoacid. In the process, the cofactor shuttles between PLP and the pyridoxamine phosphate (PMP) form. The amino group transfer catalyzed by this enzyme is crucial in both amino acid degradation and biosynthesis. In amino acid degradation, following the conversion of α-ketoglutarate to glutamate, glutamate subsequently undergoes oxidative deamination to form ammonium ions, which are excreted as urea. In the reverse reaction, aspartate may be synthesized from oxaloacetate, which is a key intermediate in the citric acid cycle. Two isoenzymes are present in a wide variety of eukaryotes. In humans:
Donald has supervised many students and postdocs, many of whom are now professors in reputed universities such as MIT, Carnegie-Mellon University, University of Washington, Seattle, University of Massachusetts Amherst, Dartmouth College, Duke University, Middlebury College and University of Toronto, and researchers at organizations such as NIAID, NIST, IBM, Sandia National Laboratories. Donald is the son of historian David Herbert Donald and historian and editor Aida DiPace Donald. MEMS Protein design NMR Protein Structure Kinodynamic planning Donald is the author of over 100 publications. A representative selection includes:
An aldehyde tag is a short peptide tag that can be further modified to add fluorophores, glycans, PEG (polyethylene glycol) chains, or reactive groups for further synthesis. A short, genetically-encoded peptide with a consensus sequence LCxPxR is introduced into fusion proteins, and by subsequent treatment with the formylglycine-generating enzyme (FGE), the cysteine of the tag is converted to a reactive aldehyde group. This electrophilic group can be targeted by an array of aldehyde-specific reagents, such as aminooxy- or hydrazide-functionalized compounds.
Sources: en.wikipedia.org
FO is a water insoluble protein with eight subunits and a transmembrane ring. The ring has a tetrameric shape with a helix-loop-helix protein that goes through conformational changes when protonated and deprotonated, pushing neighboring subunits to rotate, causing the spinning of FO which then also affects conformation of F1, resulting in switching of states of alpha and beta subunits. The FO region of ATP synthase is a proton pore that is embedded in the mitochondrial membrane. It consists of three main subunits, a, b, and c. Six c subunits make up the rotor ring, and subunit b makes up a stalk connecting to F1 OSCP that prevents the αβ hexamer from rotating. Subunit a connects b to the c ring. Humans have six additional subunits, d, e, f, g, F6, and 8 (or A6L). This part of the enzyme is located in the mitochondrial inner membrane and couples proton translocation to the rotation that causes ATP synthesis in the F1 region. In eukaryotes, mitochondrial FO forms membrane-bending dimers. These dimers self-arrange into long rows at the end of the cristae, possibly the first step of cristae formation. An atomic model for the dimeric yeast FO region was determined by cryo-EM at an overall resolution of 3.6 Å.
Automated synthesis or automatic synthesis is a set of techniques that use robotic equipment to perform chemical synthesis using a robotic system run using software control. Automating processes allows for higher efficiency and product quality although automation technology can be cost-prohibitive and there are concerns regarding overdependence and job displacement. Chemical processes were automated throughout the 19th and 20th centuries, with major developments happening in the previous thirty years, as technology advanced. Tasks that are performed may include: synthesis in variety of different conditions, sample preparation, purification, and extractions. Applications of automated synthesis are found on research and industrial scales in a wide variety of fields including polymers, personal care, and radiosynthesis.
Enzyme specificity refers to the interactions between any particular enzyme and its corresponding substrate. In addition to the specificity in binding its substrates, correct proximity and orientation as well as binding the transition state provide an additional layer of enzyme specificity. Enzymes vary in the specificity of the substrates that they bind to, in order to carry out specific physiological functions. Some enzymes may need to be less specific and therefore may bind to numerous substrates to catalyze a reaction. On the other hand, certain physiological functions require extreme specificity of the enzyme for a single specific substrate in order for a proper reaction and physiological phenotype to occur. The different types of categorizations differ based on their specificity for substrates. Most generally, they are divided into four groups: absolute, group, linkage, and stereochemical specificity.
In molecular biology, ATP10 protein (mitochondrial ATPase complex subunit ATP10) is an ATP synthase assembly factor. It is essential for the assembly of the mitochondrial F1-F0 complex. A yeast nuclear gene (ATP10) encodes a product that is essential for the assembly of a functional mitochondrial ATPase complex. Mutations in ATP10 induce a loss of rutamycin sensitivity in the mitochondrial ATPase, but do not affect the respiratory enzymes. ATP10 has a molecular weight of 30,293 Da and its primary structure is not related to any known subunit of the yeast or mammalian mitochondrial ATPase complexes. ATP10 is associated with the mitochondrial membrane. It is suggested that the ATP10 product is not a subunit of the ATPase complex but rather a protein required for the assembly of the F0 sector of the complex.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Sources: en.wikipedia.org
ALK-positive ALCL is diagnosed by histological and immunological examinations of involved tissues, typically lymph nodes. These tissues have lymphoma-like infiltrates that have variable numbers of ALCL "hallmark" cells, i.e. cells with kidney- or horseshoe-shaped nuclei that strongly express CD30 as detected by immunohistochemistry and an ALK fusion protein as detected by fluorescence in situ hybridization. These cells are scattered throughout the infiltrates. WHO classifies these infiltrates into 5 patterns: a common pattern consisting of large variably shaped cells with large nuclei that typically contain multiple nucleoli (60–70% of cases); a small-cell pattern consisting of small to medium-sized neoplastic cells with clear cytoplasm and "hallmark" cells that are concentrated around small blood vessels (5–10% of cases); a lymphohistiocytic pattern consisting of small neoplastic cells along with abundant histiocytes (10% of cases); a Hodgkin's-like pattern in which the architecture resembles the nodular sclerosis pattern of Hodgkin lymphoma (3% of cases); and a composite pattern consisting of two or more of the just described patterns (15% of cases). Detection of circulating autoantibody against ALK supports the diagnosis. Individuals with low levels of these autoantibodies are at an increase risk of relapsing after treatment.
Immunofluorescence imaging in the human U2OS cell line (bone Osteosarcoma epithelial cells) shows localization in the cytosol. Immunohistochemistry imaging of human prostate tissue also suggests cytosolic localization. A bipartite nuclear localization signal is predicted at position 128 – 143, which is highly conserved in mammalian orthologs (see Fig.2.), indicating possible localization in the nucleus. The predicted promoter sequence for this gene spans from base pair 37196852 to 37198126 (1,275 bp) and has multiple predicted binding sites for transcription factors such as GATA binding factors, SMAD3, TP63 and NRF1. MIPOL1 is ubiquitously expressed at low levels in humans, with highest expression in the prostate. The RNA secondary structure is stabilized by multiple stem loops that have been predicted (using bioinformatics tools), and conserved across closely related species. Multiple binding targets are found for microRNAs such as MIR3163 and MIR190a, that could silence these regions on the mRNA and inhibit translation.
Most atomic nuclei contain protons and neutrons. The number of protons determines the chemical element the nucleus belongs to. Different isotopes of the same element have different numbers of neutrons in their nuclei, but contain the same number of protons. For example, isotopes of carbon include carbon-12, carbon-13, carbon-14, which contain 6, 7, 8 neutrons respectively, but all contain 6 protons. Each isotope of an element has a different nuclear energy state, and may have different stability.
The AAV genome is built of single-stranded deoxyribonucleic acid (ssDNA), either positive- or negative-sensed, which is about 4.7 kilobase long. The genome comprises ITRs at both ends of the DNA strand, and two open reading frames (ORFs): rep and cap. The former is composed of four overlapping genes encoding Rep proteins required for the AAV life cycle, and the latter contains overlapping nucleotide sequences of capsid proteins: VP1, VP2 and VP3, which interact to form a capsid with icosahedral symmetry.
Pituitary prolactin is controlled by the Pit-1 transcription factor, which binds to the gene at several sites including a proximal promoter. This promoter is inhibited by dopamine and stimulated by estrogens, neuropeptides, and growth factors. Estrogens can also suppress dopamine. Interaction with neuropeptides is still a matter of active research: no specific prolactin-releasing hormone has been identified. It is known that mice react to both VIP and TRH, but humans seem to only react to TRH. There are prolactin-releasing peptides that work in vitro, but whether they deserve their name has been questioned. Oxytocin does not play a large role. Mice without a posterior pituitary do not raise their prolactin levels even with suckling and oxytocin injection, but scientists have yet to identify which specific hormone produced by this region is responsible. In birds (turkeys), VIP is a powerful prolactin-releasing factor, while peptide histidine isoleucine has almost no effect.
Sources: en.wikipedia.org
It measures the amounts and identities of compounds in liquid samples by separation and detection. Depending on the detector and reference standards, results can be qualitative or quantitative. The technique is used in fields such as pharmaceutical analysis, food safety, and environmental monitoring.
Performance checks confirm that the chromatographic system works within preset limits before results are accepted. They examine factors such as peak resolution, tailing, and repeatability. If criteria fail, the run may need correction or repetition.
Retention time alone is not definitive proof because other compounds can elute at similar times. Confirmation usually uses a second method, a different column, or a detector such as mass spectrometry. Authentic standards strengthen identification.
It separates components in a liquid sample and measures their amounts using a detector. Results can indicate concentration, purity, or identity based on retention time and detector response. The technique works for mixtures that can be dissolved and filtered.