This is a working overview of precision, written for readers who want more than a one-paragraph summary but less than a textbook.
Reviewed 2025-10-30. Anything still debated is marked as such rather than presented as settled.
Quality control laboratories use HPLC to check identity, purity, concentration, and stability of raw materials and finished products. A validated method specifies the column, mobile phase, flow rate, detection wavelength, injection volume, and run time. Samples are prepared and compared against reference standards of known concentration. The resulting chromatogram provides quantitative data, such as assay values and impurity levels. This approach is common in pharmaceutical, food, environmental, and industrial testing where consistent measurements are required.
Method validation demonstrates that an analytical procedure is suitable for its intended purpose. Typical validation characteristics include accuracy, precision, specificity, linearity, range, limit of detection, limit of quantitation, and robustness. Regulatory guidance from bodies such as the International Council for Harmonisation and the United States Pharmacopeia outlines expectations, though specific criteria depend on the product and method. System suitability tests are run before sample analysis to confirm resolution, peak symmetry, column efficiency, and injection repeatability. Failure of these checks can invalidate a batch of measurements.
Practical HPLC testing depends on careful sample preparation and instrument maintenance. Samples may require filtration, dilution, pH adjustment, or extraction to avoid column damage and matrix interference. Mobile phases are degassed and filtered, and columns are equilibrated before injection. Common problems include peak tailing, baseline drift, ghost peaks, carryover, and co-elution of analytes. Documentation of instrument logs, calibration records, and electronic audit trails supports data integrity and traceability. Ongoing training and routine maintenance help reduce variability between analysts and laboratories.
Reversed-phase chromatography dominates modern HPLC testing, using a nonpolar stationary phase such as chemically bonded octadecyl groups and a polar mobile phase of water mixed with organic solvent. Analytes partition between the mobile and stationary phases according to hydrophobicity. Gradient elution changes the mobile phase composition over time to separate compounds with a wide range of retention. Isocratic elution keeps the composition constant and is simpler for routine assays. Column temperature, pH, and flow rate influence selectivity, peak shape, and retention time, so these parameters are controlled during a validated method.
Detection in HPLC testing commonly relies on ultraviolet-visible absorbance, fluorescence, refractive index, or mass spectrometry. A diode array detector records full spectra across a wavelength range, which helps identify co-eluting peaks. Mass spectrometry provides mass-to-charge ratios and can confirm molecular identity at low concentrations. The choice of detector depends on analyte structure, required sensitivity, and whether quantitation or identification is the goal. No single detector works for every compound, and method development often compares responses before selecting one.
| Parameter | Typical acceptance criterion | Notes |
|---|---|---|
| Resolution | ≥ 1.5 | Baseline separation of adjacent peaks |
| Tailing factor | ≤ 2.0 | Peak symmetry measure |
| Theoretical plates | > 2000 | Column efficiency indicator |
| Injection repeatability | ≤ 2% RSD | Relative standard deviation for replicate injections |
| Linearity | r² ≥ 0.995 | Calibration curve over the working range |
Method validation establishes that an HPLC procedure is suitable for its intended use. Key parameters include accuracy, precision, specificity, linearity, range, limit of detection, limit of quantitation, and robustness. Accuracy measures agreement with a true or accepted value, while precision describes repeatability and intermediate precision. Specificity confirms that the method measures the analyte without interference from impurities, degradants, or excipients. Validation is documented in a protocol and report, and acceptance criteria are set before experiments begin. Regulatory guidance varies by region, but the general principles are widely harmonized.
System suitability testing is performed before and during analytical runs to confirm that the instrument and method are working as expected. Common checks include retention time, peak area, resolution between critical pairs, tailing factor, and theoretical plate count. Results are compared with predefined limits, and a failed check requires investigation before sample results are reported. Quality control samples at low, middle, and high concentrations are injected at intervals to monitor accuracy and precision. Blank injections detect carryover and contamination, while control charts track performance over time.
Data handling and documentation are central to HPLC quality control. Electronic systems should have audit trails that record changes to methods, sequences, and results. Integration parameters, such as peak baseline and threshold, can affect reported areas and must be defined in advance. Out-of-specification results trigger a structured investigation that may include reanalysis, instrument checks, and review of sample preparation. Regulatory inspections often examine raw data, audit trails, and training records to verify that reported results are traceable and reliable.
Separation in HPLC depends on the chemistry of the stationary phase, the composition of the mobile phase, and the physical properties of the column. Reverse-phase separations use a nonpolar stationary phase and a polar mobile phase, and they are common for many organic compounds. Ion-exchange, size-exclusion, and normal-phase modes serve other classes of analytes. Gradient elution changes solvent strength over time, while isocratic elution holds it constant. Flow rate, temperature, particle size, and column length all influence peak shape and resolution. Detection may use ultraviolet absorbance, fluorescence, refractive index, or mass spectrometry, depending on the analyte and the required sensitivity.
Routine HPLC testing compares a sample result with a calibration curve prepared from known reference standards. Peak area or peak height is plotted against concentration, and the curve is used to estimate unknown amounts. Retention time supports tentative identification when compared with a standard, though mass spectrometry or another confirmatory method may be needed for definitive identification. Pre-run checks verify repeatability, resolution, and peak symmetry before sample analysis. Limits of detection and quantification describe the smallest amounts that can be reliably observed or measured. Sample preparation, filtration, and degassing help prevent column damage and inconsistent results.
High-performance liquid chromatography is an analytical technique that separates components in a liquid sample. A pump moves a liquid mobile phase through a column packed with a solid stationary phase. Compounds interact differently with both phases and travel at different rates, leaving the column at distinct retention times. A detector records these arrivals as peaks on a chromatogram. The resulting pattern supports identification and quantification of substances in mixtures. Modern instruments use high pressure to force solvent through small particles, which improves speed and resolution compared with older low-pressure liquid chromatography methods.
Regulatory and pharmacopeial texts shape how HPLC testing is performed and documented. The International Council for Harmonisation provides validation guidance, while pharmacopeias publish general chromatography chapters and monographs for specific materials. Accreditation standards such as ISO/IEC 17025 address laboratory competence and traceability. Inspectors may review instrument qualification, analyst training, reference material control, and electronic records. Open questions include how best to validate methods for new complex products and how to handle automated data processing. Laboratories generally resolve these issues through risk assessment, method lifecycle management, and documented scientific justification.
In quality control laboratories, HPLC testing supports batch release, raw material checks, stability studies, and impurity profiling. A validated method defines sample preparation, instrument settings, calibration, and acceptance criteria. Analysts compare results with specifications and investigate out-of-specification outcomes before a batch is approved. Documentation includes chromatograms, integration records, audit trails, and reagent details. Because results influence product decisions, laboratories follow formal quality systems and data integrity rules. The exact tests and limits depend on the material, its intended use, and the applicable regulatory framework.
Method validation examines whether an HPLC procedure is suitable for its intended purpose. Common parameters include accuracy, precision, specificity, linearity, range, detection limit, quantification limit, and robustness. Accuracy describes closeness to a true or accepted value, while precision describes agreement among repeated measurements. Specificity shows whether the method can measure the analyte without interference from related substances. Robustness tests small deliberate changes in flow, temperature, or solvent composition. Validation is not a one-time event; methods may need partial revalidation after changes to instruments, columns, sample handling, or specification limits. Regulatory guidance provides frameworks, but some details remain method-specific.
Parker was born in March 1938, and was the only daughter of Frederick and Hilda Witcomb (née Linscott). She was married to Joseph Parker, a Post Office engineer, and lived in the Kings Norton area of Birmingham. After several years as a police photographer, she joined the University of Birmingham Medical School, where she was employed as a medical photographer in the Anatomy Department. She often worked in a darkroom above the laboratory where research on smallpox viruses was being conducted.
PABA and its salts are used in nutritional epidemiological studies to assess the completeness of 24-hour urine collection for the determination of urinary sodium, potassium, or nitrogen levels. The potassium salt (potassium paraaminobenzoate, "aminobenzoate potassium") is used as a drug against fibrotic skin disorders, such as Peyronie's disease, under the brand name Potaba. There is a lack of strong evidence. It is believed to work by inhibiting fibroblast glycosaminoglycan secretion and stabilizing monoamine oxidase A activity. PABA is also occasionally used in pill form by sufferers of irritable bowel syndrome to treat its associated gastrointestinal symptoms. PABA derivatives have also been proposed to function as acetylcholinesterase inhibitors in diseases that cause deficient cholinergic systems, such as Alzheimer's disease.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Affinity chromatography can be used in a number of applications, including nucleic acid purification, protein purification from cell free extracts, and purification from blood. By using affinity chromatography, one can separate proteins that bind to a certain fragment from proteins that do not bind that specific fragment. Because this technique of purification relies on the biological properties of the protein needed, it is a useful technique and proteins can be purified many folds in one step.
Sources: en.wikipedia.org
an intermediate or building block in the synthesis of non-ionic and other surfactants and related functional additives; a component of lubricant and plastic additive systems, including thermoplastic polyurethanes, where long-chain alcohols are used to modify flexibility and permeability; a minor constituent of policosanol-type mixtures employed in cosmetics and personal-care products as part of the lipid phase of creams and emulsions. Because of its chain length and structural similarity to other fatty alcohols, 1-heneicosanol is also used as a reference compound and analytical standard in studies of plant waxes, policosanol mixtures and related lipid fractions. Available safety data sheets describe 1-heneicosanol as a low-volatility solid that is not classified as hazardous under European CLP regulations, but which may cause mild irritation to the skin, eyes and respiratory tract on contact or inhalation of dust. Standard laboratory precautions such as avoiding dust formation, using local exhaust ventilation and wearing eye and skin protection are recommended.
Patients with Type II diabetes will have elevated glucagon levels during a fast and after eating. These elevated glucagon levels over stimulate the liver to undergo gluconeogenesis, leading to elevated blood glucose levels. Consistently high blood glucose levels can lead to organ damage, neuropathy, blindness, cardiovascular issues and bone and joint problems. It is not entirely clear why glucagon levels are so high in patients with Type II diabetes. One theory is that the alpha cells have become resistant to the inhibitory effects of glucose and insulin and do not respond properly to them. Another theory is that nutrient stimulation of the gastrointestinal tract, thus the secretion of gastric inhibitory polypeptide and Glucagon-like peptide-1, is a very important factor in the elevated secretion of glucagon.
AlphaFold's predicted structures are widely used in biological research, though the precise scale of that use is difficult to measure. More than 40% of protein-structure papers published in 2023 in Cell, Nature, and Science cited AlphaFold 2. A 2024 bibliometric analysis of the Web of Science database identified 1,680 peer-reviewed papers referencing AlphaFold published between January 2019 and May 2024. Measures of this kind rely on authors citing the AlphaFold papers when they use the tool, a convention encouraged but not enforced by the maintainers of the AlphaFold Protein Structure Database. Attempts to validate these counts against the full text of papers suggest that citations to foundational AlphaFold papers can both overstate and understate how widely the tool is used. In an analysis of about 8,900 papers in the PubMed Central Open Access corpus that mentioned AlphaFold, roughly 30% cited none of three foundational AlphaFold papers, while only about half of the papers citing at least one of those three mentioned AlphaFold anywhere in their text. A smaller manual check of 100 papers from a curated protein-literature database found a similar shortfall, with fewer than half of those mentioning AlphaFold including a formal citation.
Sources: en.wikipedia.org
As of 2020, normal ALP levels were "not well defined", and there tend to be variations by sex and racial background, and by age, with children and adolescents having markedly higher levels. There are many possible explanations for elevated ALP. When the cause is unclear, isoenzyme studies using electrophoresis can confirm the source of the increase. Skelphosphatase (which is localized in osteoblasts and extracellular layers of newly synthesized matrix) is released into circulation by a yet unclear mechanism. Placental alkaline phosphatase is elevated in seminomas and active forms of rickets, as well as in the following diseases and conditions: Biliary obstruction Bone conditions Osteoblastic bone tumors Osteomalacia Osteoporosis Hepatitis Mononucleosis Cirrhosis Acute cholecystitis Myelofibrosis Leukemoid reaction Congestive heart failure Lymphoma Paget's disease Sarcoidosis Hyperthyroidism Hyperparathyroidism Myocardial infarction Cholangitis Ischemic cholangiopathy Pregnancy High doses of estrogens
In 1942, Hugh DeHaven published the classic Mechanical analysis of survival in falls from heights of fifty to one hundred and fifty feet. In 1947, the American Tucker was built with the world's first padded dashboard. It also came with middle headlight that turned with the steering wheel, a front steel bulkhead, and a front safety chamber. In 1949, SAAB incorporated aircraft safety thinking into automobiles making the Saab 92 the first production SAAB car with a safety cage. Also in 1949, the Chrysler Imperial Crown was the first car to come with standard disc brakes.
Closer Roberto Osuna converted his 25th consecutive save on May 24, breaking a club record. The streak had started the previous August 18, surpassing Brad Lidge (24 consecutive from June 21–September 28, 2005). Osuna's feat remained the franchise longest until Josh Hader converted 29 consecutive from April 7 to August 29, 2024. On May 28, A. J. Hinch obtained his 500th win as manager, as the Astros toppled the Chicago Cubs, 9–6. Chicago blasted five home runs, but Houston answered with five doubles—two by Jake Marisnick (8)—and two home runs by Alex Bregman (17). Bregman collected three RBI, and Michael Brantley had two hits and two RBI as Houston scored four times in the bottom of the fourth. Josh James (2–0) picked up the victory in relief while surrendering three runs over 2+1⁄3 frames. With injuries stacking up, on May 29 shortstop Carlos Correa sustained a bruised rib during a massage session. He was forced to join fellow All-Stars Springer and Jose Altuve on the injured list (IL) and expected to miss four to six weeks.
Not much is known about the mutations in the genes OBS1and CCD8 and their function in growth and development so far. However, the implications of 3M syndrome suggest that both these genes encode for proteins that play a role in the CUL7 ubiquination pathway. Due to the fact that many of the abnormalities associated with this disorder are congenital, the presence of these clinical features at birth is usually sufficient to make the diagnosis. Diagnosis is suggested in children with the following: low birth weight, severe growth retardation, typical facial features, and characteristic radiological findings. In some cases, growth retardation and/or other characteristic findings suggestive of Three M syndrome may be detected before birth by ultrasound. In fetal ultrasonography, reflected sound waves are used to create an image of the developing fetus.
Sources: en.wikipedia.org
Method validation is the documented process of confirming that an HPLC procedure is suitable for its intended use. It evaluates accuracy, precision, specificity, linearity, range, detection limits, and robustness. Validation criteria depend on the regulatory context and the sample type.
System suitability tests are short checks performed before or during an HPLC run to verify instrument and method performance. They often include resolution, tailing factor, theoretical plates, and injection precision. Results must meet predefined limits for sample data to be accepted.
HPLC retention time alone cannot definitively identify an unknown substance. A match with a reference standard under identical conditions provides supporting evidence. Confirmation typically requires mass spectrometry, nuclear magnetic resonance, or another orthogonal technique.
HPLC testing separates and quantifies components in a liquid sample. It is used to check identity, purity, concentration, or stability. The technique works best for compounds that dissolve and are not easily vaporized.