This is a working overview of calibration curve, written for readers who want more than a one-paragraph summary but less than a textbook.
Reviewed 2026-01-28. Anything still debated is marked as such rather than presented as settled.
Laboratories apply HPLC testing across pharmaceutical, food, environmental, and industrial chemistry. The method can measure active ingredients, impurities, additives, preservatives, and degradation products. Sample preparation often includes dilution, filtration, and sometimes extraction or derivatization. The choice of column, mobile phase, pH, temperature, and detector depends on the analytes and matrix. Results are compared with reference standards to assign identity and concentration. Method suitability is judged by resolution, precision, and accuracy.
HPLC testing is not a single fixed procedure; it is a family of separation modes. Reversed-phase, normal-phase, ion-exchange, size-exclusion, and affinity chromatography each suit different analyte properties. Reversed-phase methods dominate because they handle many neutral and moderately polar compounds. Detection can be optical, electrochemical, or mass spectrometric, and the detector dictates what information is available. Coupling with mass spectrometry increases selectivity and enables identification when standards are unavailable. The technique cannot separate every mixture without adjustment.
Routine quality control monitors retention time shifts, baseline noise, system pressure, and peak shape. Trends can reveal column aging, mobile phase preparation errors, detector drift, or sample degradation. Corrective actions may include replacing the column, preparing fresh mobile phase, or recalibrating the detector. Stability testing often uses HPLC to measure parent compound loss and degradation product formation. Open questions remain about how accelerated stability results extrapolate to long-term storage under varied conditions.
Quality control for HPLC testing combines scheduled checks, documented procedures, and review of results. Before sample analysis, system suitability testing confirms that the instrument, column, and method meet predefined criteria. Common criteria include resolution between critical peaks, retention time precision, peak tailing, and theoretical plate count. Failure triggers investigation before results are reported. Records link raw data, calculations, instrument logs, and analyst identity to each batch, supporting audits and repeat analysis.
Method validation evaluates accuracy, precision, specificity, linearity, range, detection limit, quantitation limit, and robustness. Regulatory guidance for pharmaceuticals, foods, and environmental testing defines expected documentation and acceptance criteria. Verification confirms that a validated method works in a specific laboratory with its own instruments and reagents. Calibration curves use reference standards with known purity and traceability, while measurement uncertainty is estimated from validation data, control charts, and collaborative studies. The scope of validation depends on the method's intended use.
| Property | Value | Notes |
|---|---|---|
| Abbreviation | HPLC | Also called high-performance liquid chromatography |
| Separation mechanism | Differential partitioning | Compounds distribute between mobile and stationary phases |
| Typical column chemistry | C18 (octadecylsilane) | Used in reversed-phase separations |
| Typical detector | UV-Vis or photodiode array | Mass spectrometry is common for trace and confirmatory work |
| Typical particle size | 1.8–5 µm | Smaller particles require higher pressure and can improve speed |
System suitability testing is performed before and during analytical runs to confirm that the instrument and method are working as expected. Common checks include retention time, peak area, resolution between critical pairs, tailing factor, and theoretical plate count. Results are compared with predefined limits, and a failed check requires investigation before sample results are reported. Quality control samples at low, middle, and high concentrations are injected at intervals to monitor accuracy and precision. Blank injections detect carryover and contamination, while control charts track performance over time.
Data handling and documentation are central to HPLC quality control. Electronic systems should have audit trails that record changes to methods, sequences, and results. Integration parameters, such as peak baseline and threshold, can affect reported areas and must be defined in advance. Out-of-specification results trigger a structured investigation that may include reanalysis, instrument checks, and review of sample preparation. Regulatory inspections often examine raw data, audit trails, and training records to verify that reported results are traceable and reliable.
VIP is highly localised in lungs (70%) and binds with alveolar type II (AT II) cells via VPAC1. The biological (vasodilator) activity of vasoactive intestinal peptide (VIP) was discovered in the lungs before the peptide was isolated and chemical identity characterized from intestine. VIP levels are also considerably high in the brain and the gut. It is localized in key sites in the lung, has potent activities on its major functions, and appears to play an important role in pulmonary physiology and disease. The principal localization of VIP-containing neurons in the tracheobronchial tree is in the smooth muscle layer, around submucosal mucous glands and in the walls of pulmonary and bronchial arteries. Immunoreactive VIP is also present in neuronal cell bodies forming microglia that provide a source of intrinsic innervation of pulmonary structures.
Imaging technologies are often essential to medical diagnosis, and are typically the most complex equipment found in a hospital including: fluoroscopy, magnetic resonance imaging (MRI), nuclear medicine, positron emission tomography (PET), PET-CT scans, projection radiography such as X-rays and CT scans, tomography, ultrasound, optical microscopy, and electron microscopy. An implant is a kind of medical device made to replace and act as a missing biological structure (as compared with a transplant, which indicates transplanted biomedical tissue). The surface of implants that contact the body might be made of a biomedical material such as titanium, silicone or apatite depending on what is the most functional. In some cases, implants contain electronics, e.g. artificial pacemakers and cochlear implants. Some implants are bioactive, such as subcutaneous drug delivery devices in the form of implantable pills or drug-eluting stents.
The alpha-1B adrenergic receptor (α1B-adrenoreceptor), also known as ADRA1B, is an alpha-1 adrenergic receptor, and also denotes the human gene encoding it. The crystal structure of the α1B-adrenergic receptor has been determined in complex with the inverse agonist (+)-cyclazosin. There are 3 alpha-1 adrenergic receptor subtypes: alpha-1A, -1B and -1D, all of which signal through the Gq/11 family of G-proteins and different subtypes show different patterns of activation. They activate mitogenic responses and regulate growth and proliferation of many cells. This gene encodes alpha-1B-adrenergic receptor, which induces neoplastic transformation when transfected into NIH 3T3 fibroblasts and other cell lines. Thus, this normal cellular gene is identified as a protooncogene. This gene comprises 2 exons and a single large intron of at least 20 kb that interrupts the coding region. Antagonists L-765,314 Risperidone Brexpiprazole Tamsulosin Alpha-1B adrenergic receptor has been shown to interact with AP2M1. A role in regulation of dopaminergic neurotransmission has also been suggested.
There are three amino acids with side chains that are cations at neutral pH: arginine (Arg, R), lysine (Lys, K) and histidine (His, H). Arginine has a charged guanidino group and lysine a charged alkyl amino group, and are fully protonated at pH 7. Histidine's imidazole group has a pKa of 6.0, and is only around 10% protonated at neutral pH. Because histidine is easily found in its basic and conjugate acid forms it often participates in catalytic proton transfers in enzyme reactions.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Sources: en.wikipedia.org
Degradation of an amino acid often begins with transamination, in which its amino group is transferred to α-ketoglutarate, forming glutamate. This process involves transaminases, often the same enzymes used in amino acid synthesis. In many vertebrates, the amino group is subsequently released as ammonia and converted to urea via the urea cycle for excretion. However, amino acid degradation can result in uric acid or ammonia instead, depending on the organism. For example, serine dehydratase converts serine directly to pyruvate and ammonia. After removal of one or more amino groups, the remaining carbon skeleton of an amino acid can serve as a precursor for synthesizing other amino acids, be further metabolized for energy after conversion into intermediates of glycolysis (typically via gluconeogenesis) or of the citric acid cycle, or be used for fatty acid synthesis and storage as triacylglycerol. Amino acids are bidentate ligands, forming transition metal amino acid complexes.
Cervical drug delivery is a route of carrying drugs into the body through the vagina and cervix. This is a form of localized drug delivery that prevents the drugs from impacting unintended areas of the body, which can lower side effects of toxic drugs such as chemotherapeutics. Cervical drug delivery has specific applications for a variety of female health issues: treatment of cervical cancer, pregnancy prevention, STD prevention, and STD treatment.
ASBMB Award for Exemplary Contributions to Education ASBMB Leadership Awards ASBMB–Merck Award ASBMB Young Investigator Award Avanti Award in Lipids Bert and Natalie Vallee Award in Biomedical Science DeLano Award for Computational Biosciences Earl and Thressa Stadtman Distinguished Scientist Award Earl and Thressa Stadtman Young Scholar Award Herbert Tabor Research Award Mildred Cohn Award in Biological Chemistry - The Mildred Cohn Award in Biological Chemistry was established in 2013 to honor the scientific achievements of Mildred Cohn. Cohn was the first female president of the society, in 1978. The award of $5,000 is presented annually to a scientist who has made substantial advances in understanding biological chemistry using innovative physical approaches. The recipient is expected to deliver the Mildred Cohn Award lecture at the annual meeting. Ruth Kirschstein Diversity in Science Award The Alice and C. C. Wang Award in Molecular Parasitology Walter A. Shaw Young Investigator Award in Lipid Research William C. Rose Award
In Mexico, the Directorate General of Civil Aviation (DGAC) investigates aviation accidents. In the Netherlands, the Dutch Safety Board (Onderzoeksraad voor Veiligheid) is responsible for the investigation of incidents and accidents, including air accidents. Its aim is the improvement of safety in the Netherlands. Its main focus is on those situations in which civilians are dependent on the government, companies or organizations for their safety. The Board solely investigates when incidents or accidents occur and aims to draw lessons from the results of these investigations. The Safety Board is objective, impartial and independent in its judgment. The Board will always be critical towards all parties concerned.
Sources: en.wikipedia.org
Yonath was accepted to Tichon Hadash high school since her mother could not pay the tuition, she traded her time teaching math lessons to students, which helped pay for her schooling. At a young age, she said, she was inspired by the scientist Marie Curie. However, she stressed that Curie, whom she as a child was fascinated by after reading her biography, was not her "role model". She returned to Jerusalem for college, graduating from the Hebrew University of Jerusalem with a bachelor's degree in chemistry in 1962, and a master's degree in biochemistry in 1964. In 1968, she obtained her PhD from the Weizmann Institute of Science for X-ray crystallographic studies on the structure of collagen, with Wolfie Traub as her PhD advisor. Yonath accepted postdoctoral positions at Carnegie Mellon University (1969) and MIT (1970). While a postdoctoral researcher at MIT she spent some time in the laboratory of subsequent 1976 chemistry Nobel Prize winner William N. Lipscomb, Jr. of Harvard University where she was inspired to pursue very large structures.
5-HEDH is an NADPH dehydrogenase oxidoreductase enzyme. It transfers a hydrogen cation (or hydron) H+ from 5(S)-hydroxy (i.e. 5(S)-OH) residues of its fatty acid targets to nicotinamide adenine dinucleotide phosphate+ (NADP+) to form 5-oxo (i.e. 5-O=) counterparts of its targets plus reduced NADP+, i.e. NADPH. The reaction (where R indicates a long chain [14 or more carbons] fatty acid) is: NADP+ + 5(S)-hydroxy fatty acid (i.e. 5(S)-OH-R) ⇌ {\displaystyle \rightleftharpoons } NADPH + H+ + oxo fatty acid (i.e. 5-O=R) The reaction appears to follow a ping-pong mechanism. It is fully reversible, readily converting 5-oxo targets to their corresponding 5(S)-hydroxy counterparts. The direction of this reaction is dependent on the level of NADP+ relative to that of NADPH: The immediate metabolic precursor to 5(S)-HETE, 5(S)-hydroperoxy-6S,8Z,11Z,14Z-eicosatetraenoic acid 5(S)-HpETE, can be converted to 5-oxo-ETE in a non-enzymatic dehydration reaction or chemical lipid peroxidation reactions. The physiological occurrence and relevancy of these reaction pathways has not been ascertained.
In pharmacology, relative bioavailability measures the bioavailability (estimated as the AUC) of a formulation (A) of a certain drug when compared with another formulation (B) of the same drug, usually an established standard, or through administration via a different route. When the standard consists of intravenously administered drug, this is known as absolute bioavailability (see above). F r e l = 100 ⋅ A U C A ⋅ D B A U C B ⋅ D A {\displaystyle F_{\mathrm {rel} }=100\cdot {\frac {AUC_{\mathrm {A} }\cdot D_{\mathrm {B} }}{AUC_{\mathrm {B} }\cdot D_{\mathrm {A} }}}}
Sources: en.wikipedia.org
It measures the presence and amount of one or more compounds in a liquid sample. Separation occurs in a column, and detection produces a signal proportional to concentration. Identification usually requires comparison with a known reference standard under the same conditions.
In most cases the sample is consumed or altered during analysis, though some detectors are non-destructive. Fractions can be collected after separation for further study. Repeated testing therefore requires additional sample.
Run times range from under a minute for fast methods to over an hour for complex separations. Sample preparation, equilibration, and data review add time. Throughput depends on instrument configuration and method requirements.
System suitability is typically performed before each batch or according to the validated method and laboratory procedure. Some long runs include periodic checks during analysis. The required frequency depends on regulatory expectations and method performance.